Sermorelin 10mg

Original price was: $60.00.Current price is: $40.00.

One vial of Sermorelin 10 mg is now $40 for a limited time.

Compound: Sermorelin (GHRH 1-29 Amide / GRF 1-29)
Concentration: 10mg per vial
Format: Lyophilized Powder
Purity: >99% Purity Level
Quality: Verified Research Peptide
Chemical Classification: Synthetic Growth Hormone-Releasing Hormone Fragment / Amidated 29-Amino-Acid Peptide

Chemical Profile: Sermorelin is a synthetic 29-amino-acid peptide corresponding to the biologically active N-terminal region of human Growth Hormone-Releasing Hormone (GHRH), also known as Growth Hormone-Releasing Factor (GRF). The peptide comprises residues 1–29 of the native 44-amino-acid GHRH sequence and incorporates C-terminal amidation. This defined structure retains affinity for the GHRH receptor and has been extensively characterized in receptor-expression and cell-signaling systems. Sermorelin provides researchers with a molecular probe for investigating GHRH receptor binding, G-protein-coupled receptor activation, cyclic AMP signaling, transcriptional regulation, and GH-axis signaling under controlled laboratory conditions.

  • Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂)
  • Mechanism: GHRH receptor agonist investigated for Gs-protein-mediated adenylyl cyclase and cAMP signaling
  • Molecular Weight: ~3,357.9 g/mol

 

Description

Research Applications & Mechanisms:

  1. GHRH Receptor Binding & Activation
    Sermorelin is utilized in receptor-expression and cell-based systems investigating interactions between GHRH-derived peptide ligands and the GHRH receptor. The receptor belongs to the seven-transmembrane G-protein-coupled receptor family, allowing researchers to examine ligand affinity, receptor activation, signaling specificity, and receptor-dependent molecular responses under controlled experimental conditions.
  2. Adenylyl Cyclase & cAMP Signaling
    Activation of the GHRH receptor is associated with coupling to Gs proteins and subsequent stimulation of adenylyl cyclase. Sermorelin can therefore be incorporated into assays measuring intracellular cyclic adenosine monophosphate (cAMP) accumulation and associated second-messenger signaling, providing a defined model for investigating GHRH receptor-mediated signal transduction.
  3. PKA & CREB-Associated Transcriptional Pathways
    Increased intracellular cAMP can activate protein kinase A (PKA), which subsequently influences transcription factors including cAMP response element-binding protein (CREB). Laboratory models utilizing Sermorelin may examine phosphorylation events, transcriptional responses, and gene-expression changes associated with this receptor-mediated signaling cascade.
  4. GHRH Receptor Regulation & Desensitization
    Experimental research has shown that GHRH receptor activation can influence subsequent receptor responsiveness and GHRH receptor mRNA expression. Sermorelin provides a useful reagent for controlled studies investigating receptor regulation, feedback signaling, desensitization, and changes in receptor-associated gene expression following repeated or sustained ligand exposure.
  5. Peptide Fragment & Structure-Activity Research
    Because Sermorelin represents the active N-terminal 1–29 region of the larger endogenous GHRH sequence, it is relevant to peptide structure-activity studies. Researchers may compare Sermorelin with full-length GHRH or modified GHRH analogs to examine how peptide length, C-terminal amidation, sequence modifications, and structural changes influence receptor affinity, signaling kinetics, and molecular stability.

Important Notices:

  • Research Use Only: This product is sold strictly for scientific research, analytical testing, and laboratory development purposes.
  • Purity & Verification: This research peptide is supplied at >99% purity and is verified for laboratory research applications.
  • Handling: The product is supplied as a lyophilized powder and should be handled using appropriate laboratory protocols for peptide stability, solubility, contamination control, and analytical preparation.
  • Visuals: Vial appearance and cap color may vary from product photos; the label quantity refers to the total active content inside the vial.

Important Legal & Safety Notice: All compounds discussed are intended for in-vitro research and analytical use only. They are not approved for human or animal consumption. Researchers are solely responsible for ensuring their handling, reconstitution, and storage protocols meet all applicable institutional, ethical, and legal standards.

 

More products