Tesamorelin 30mg Monthly Subscription

Original price was: $180.00.Current price is: $140.00. / month

Subscription of 3 vials for a total of 30mg is now $140.

Compound: Tesamorelin (GHRH / GRF Analog)
Concentration: 10mg per vial
Format: Lyophilized Powder
Chemical Classification: Synthetic Growth Hormone-Releasing Hormone (GHRH) Analog

Chemical Profile: Tesamorelin is a synthetic 44-amino-acid analog of Growth Hormone-Releasing Hormone (GHRH), also referred to as Growth Hormone-Releasing Factor (GRF). Its peptide backbone is derived from the biologically active sequence of endogenous GHRH and incorporates an N-terminal trans-3-hexenoyl modification designed to increase resistance to enzymatic degradation. In controlled laboratory systems, Tesamorelin interacts with GHRH receptors and provides researchers with a defined molecular probe for investigating receptor activation, intracellular signaling, peptide stability, and downstream GH/IGF-axis signaling pathways.

  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with an N-terminal trans-3-hexenoyl modification
  • Mechanism: GHRH receptor agonist / GRF receptor signaling ligand
  • Molecular Weight: ~5,136 g/mol

 

Description

Research Applications & Mechanisms:

  1. GHRH Receptor Binding & Activation
    Tesamorelin is utilized in controlled receptor-binding and cell-based assays investigating interactions between synthetic GHRH analogs and the GHRH receptor. Experimental models can use the peptide to characterize ligand-receptor affinity, receptor activation kinetics, and downstream signaling behavior relative to endogenous GHRH sequences.
  2. cAMP-Dependent Intracellular Signaling
    GHRH receptor activation is associated with G-protein-coupled signaling pathways involving adenylate cyclase and cyclic adenosine monophosphate (cAMP). Tesamorelin can therefore serve as a molecular probe in isolated cellular systems examining second-messenger generation, protein kinase A-associated signaling, transcriptional responses, and receptor-mediated signal amplification.
  3. GH/IGF-Axis Signaling Models
    Laboratory research utilizes GHRH analogs to investigate regulatory interactions within the growth hormone and insulin-like growth factor signaling network. Tesamorelin provides a defined reagent for studying how upstream GHRH receptor activation influences downstream molecular signaling, feedback mechanisms, and associated gene-expression patterns in appropriate experimental systems.
  4. Peptide Stability & Enzymatic Degradation
    The N-terminal structural modification of Tesamorelin makes the peptide relevant to comparative studies examining the stability of modified versus native GHRH sequences. Researchers may investigate proteolytic susceptibility, degradation kinetics, structural persistence, and the relationship between peptide modification and receptor-binding activity under controlled analytical conditions.
  5. Receptor-Mediated Gene Expression Research
    Activation of GHRH-associated signaling pathways can influence downstream transcriptional responses. Tesamorelin may be incorporated into cell-based assays examining receptor-dependent changes in gene expression, signaling-protein phosphorylation, second-messenger activity, and other measurable molecular endpoints associated with GHRH receptor activation.

Important Notices:

  • Research Use Only: This product is sold strictly for scientific research, analytical testing, and laboratory development purposes.
  • Handling: The product is supplied as a lyophilized powder and should be handled using appropriate laboratory protocols for peptide stability, solubility, contamination control, and analytical preparation.
  • Visuals: Vial appearance and cap color may vary from product photos; the label quantity refers to the total active content inside the vial.

 

Important Legal & Safety Notice: All compounds discussed are intended for in-vitro research and analytical use only. They are not approved for human or animal consumption. Researchers are solely responsible for ensuring their handling, reconstitution, and storage protocols meet all applicable institutional, ethical, and legal standards.

More products